PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe3G272100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family HD-ZIP
Protein Properties Length: 314aa    MW: 35500.8 Da    PI: 8.011
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe3G272100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.21.4e-18148202256
                        T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        rk+ +++k+q  +Le+ F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  Aqcoe3G272100.1.p 148 RKKLRLSKDQSAILEDSFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 202
                        677889***********************************************98 PP

2HD-ZIP_I/II128.82.3e-41148237191
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                        +kk+rlsk+q+++LE+sF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l++en+rL+kev+eLr +l
  Aqcoe3G272100.1.p 148 RKKLRLSKDQSAILEDSFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCENLTDENRRLQKEVQELR-AL 237
                        69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046182.1E-332121IPR006712HD-ZIP protein, N-terminal
SuperFamilySSF819951.28E-520108No hitNo description
SuperFamilySSF466891.45E-18139205IPR009057Homeodomain-like
PROSITE profilePS5007117.038144204IPR001356Homeobox domain
SMARTSM003891.8E-16146208IPR001356Homeobox domain
PfamPF000465.8E-16148202IPR001356Homeobox domain
CDDcd000868.97E-16148205No hitNo description
Gene3DG3DSA:1.10.10.609.3E-18153202IPR009057Homeodomain-like
PROSITE patternPS000270179202IPR017970Homeobox, conserved site
PfamPF021832.7E-11204238IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.1E-27204247IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008283Biological Processcell proliferation
GO:0009641Biological Processshade avoidance
GO:0009733Biological Processresponse to auxin
GO:0009735Biological Processresponse to cytokinin
GO:0009826Biological Processunidimensional cell growth
GO:0010016Biological Processshoot system morphogenesis
GO:0010017Biological Processred or far-red light signaling pathway
GO:0010218Biological Processresponse to far red light
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MMVRKDDLGL SLSLNSTEII QQQQQQQQQQ QQQQQQSSSL QLNLMPSSIS ASPFMVQKSS  60
WNEVFGSSDR GTEMYRNETR SFLRGIDVNR MPSTVDCEEE AGVSSPNSTL SSVSGKRSER  120
ETLNGEDNEI ERACSRSISD EEDGENCRKK LRLSKDQSAI LEDSFKEHNT LNPKQKLALA  180
KQLNLRPRQV EVWFQNRRAR TKLKQTEVDC EYLKRCCENL TDENRRLQKE VQELRALKLS  240
PQFYMHMTPP TTLTMCPSCE RVAVSSSSNG SAAPSTVATA TAVTPVVPHQ HRGLPWAQAP  300
IHHRPFDVLH PRS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1196204RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010275386.11e-152PREDICTED: homeobox-leucine zipper protein HAT4
SwissprotQ054661e-104HAT4_ARATH; Homeobox-leucine zipper protein HAT4
TrEMBLB9GYL81e-142B9GYL8_POPTR; Homeobox-leucine zipper family protein
STRINGPOPTR_0003s07760.11e-142(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.11e-87homeobox protein 2